Pay in 4 interest-free payments of $151.72 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
probably via an indirect effect on the expression levels of other proteins
GTELFRVPPVSTAATWQNSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLE
DUSP9 Polyclonal Antibody
MutY homolog
The Ig-like C2-type domains 3 and 4 are required for interactions with CD81
Recombinant Human KYNU/Kynureninase Protein (His Tag)(Active) - PKSH031397 Stem Cells probably via an indirect effectRecombinant Human KYNU Kynureninase Protein (His Tag)(Active) Size: 50g Catalogue Number: PKSH031397 50 Citations, Manuals and MSDS Available upon request. Abbreviation: KYNU; Kynureninase Target Symptom: KYNUU Research Area: Signal Transduction; metabolism; Target Species: Human Expression Host: Baculovirus Insect Cells Application: Enzyme Fusion Tag: C His UNIProt ID: Q16719 Accession: Q16719 Background: Protein disulfide isomerase, also known as
US$ 149.00
US$ 149.00
US$ 149.00
US$ 20.20
US$ 149.00
US$ 149.00
US$ 149.00
US$ 24.64
US$ 21.91
US$ 149.00
US$ 149.00